Lineage for d4ffua1 (4ffu A:1-148)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944578Species Sinorhizobium meliloti [TaxId:266834] [226406] (1 PDB entry)
  8. 2944579Domain d4ffua1: 4ffu A:1-148 [221170]
    Other proteins in same PDB: d4ffua2, d4ffub2, d4ffuh2, d4ffui2
    automated match to d1q6wc_
    complexed with cl

Details for d4ffua1

PDB Entry: 4ffu (more details), 1.8 Å

PDB Description: crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021
PDB Compounds: (A:) oxidase

SCOPe Domain Sequences for d4ffua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ffua1 d.38.1.0 (A:1-148) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mseqtiyyedyeqghvrltsgrtitetdfvvhaghtgdffphhmdaefaktlpggqriah
gtmifsigvgltaslinpvafsygydrlrfvrpvhigdtirtrvtiaakeddpkrpgagr
vvercevinqrgevvlaadhiliverkp

SCOPe Domain Coordinates for d4ffua1:

Click to download the PDB-style file with coordinates for d4ffua1.
(The format of our PDB-style files is described here.)

Timeline for d4ffua1: