![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
![]() | Protein automated matches [190143] (42 species) not a true protein |
![]() | Species Sinorhizobium meliloti [TaxId:266834] [226406] (1 PDB entry) |
![]() | Domain d4ffua1: 4ffu A:1-148 [221170] Other proteins in same PDB: d4ffua2, d4ffub2, d4ffuh2, d4ffui2 automated match to d1q6wc_ complexed with cl |
PDB Entry: 4ffu (more details), 1.8 Å
SCOPe Domain Sequences for d4ffua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ffua1 d.38.1.0 (A:1-148) automated matches {Sinorhizobium meliloti [TaxId: 266834]} mseqtiyyedyeqghvrltsgrtitetdfvvhaghtgdffphhmdaefaktlpggqriah gtmifsigvgltaslinpvafsygydrlrfvrpvhigdtirtrvtiaakeddpkrpgagr vvercevinqrgevvlaadhiliverkp
Timeline for d4ffua1: