Lineage for d4f7wb_ (4f7w B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845861Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins)
  6. 1845901Protein automated matches [227115] (2 species)
    not a true protein
  7. 1845905Species Klebsiella pneumoniae [TaxId:507522] [226631] (3 PDB entries)
  8. 1845917Domain d4f7wb_: 4f7w B: [221071]
    automated match to d1esma_
    complexed with adp, pn4, unx

Details for d4f7wb_

PDB Entry: 4f7w (more details), 2.1 Å

PDB Description: Crystal structure of Klebsiella pneumoniae pantothenate kinase in complex with N-pentylpantothenamide
PDB Compounds: (B:) pantothenate kinase

SCOPe Domain Sequences for d4f7wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f7wb_ c.37.1.6 (B:) automated matches {Klebsiella pneumoniae [TaxId: 507522]}
lmtpylqfnrhqwaalrdsvpmtltedeitrlkginedlsleevaeiylplsrllnfyis
snlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrhvelittd
gflhpnsvlkerglmkkkgfpqsydmhrlvkfvsdlksgvpqatapvyshliydvipdgd
ktvaqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapeellkswyinrflkf
regaftdpdsyfhnyaklskeeavdiatslwneinlmnlkenilptreraslimtksanh
svnqvrlrk

SCOPe Domain Coordinates for d4f7wb_:

Click to download the PDB-style file with coordinates for d4f7wb_.
(The format of our PDB-style files is described here.)

Timeline for d4f7wb_: