Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins) |
Protein automated matches [227115] (2 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:507522] [226631] (3 PDB entries) |
Domain d4f7wd_: 4f7w D: [221073] automated match to d1esma_ complexed with adp, pn4, unx |
PDB Entry: 4f7w (more details), 2.1 Å
SCOPe Domain Sequences for d4f7wd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f7wd_ c.37.1.6 (D:) automated matches {Klebsiella pneumoniae [TaxId: 507522]} mtpylqfnrhqwaalrdsvpmtltedeitrlkginedlsleevaeiylplsrllnfyiss nlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrhvelittdg flhpnsvlkerglmkkkgfpqsydmhrlvkfvsdlksgvpqatapvyshliydvipdgdk tvaqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapeellkswyinrflkfr egaftdpdsyfhnyaklskeeavdiatslwneinlmnlkenilptreraslimtksanhs vnqvrlrk
Timeline for d4f7wd_: