| Class b: All beta proteins [48724] (174 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
| Protein automated matches [190914] (7 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [226575] (1 PDB entry) |
| Domain d4f7ug_: 4f7u G: [221067] Other proteins in same PDB: d4f7ua_, d4f7ub_, d4f7uc_, d4f7ud_ automated match to d3swne_ complexed with p6g |
PDB Entry: 4f7u (more details), 1.9 Å
SCOPe Domain Sequences for d4f7ug_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f7ug_ b.38.1.0 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirgns
iimleale
Timeline for d4f7ug_: