| Class b: All beta proteins [48724] (178 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
| Protein D1 core SNRNP protein [50184] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [224861] (1 PDB entry) |
| Domain d4f7ua_: 4f7u A: [221062] Other proteins in same PDB: d4f7ub_, d4f7ud_, d4f7ue_, d4f7uf_, d4f7ug_, d4f7uh_, d4f7ui_, d4f7uj_ automated match to d1b34a_ complexed with p6g |
PDB Entry: 4f7u (more details), 1.9 Å
SCOPe Domain Sequences for d4f7ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f7ua_ b.38.1.1 (A:) D1 core SNRNP protein {Mouse (Mus musculus) [TaxId: 10090]}
mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
rgnniryfilpdslpldtllvd
Timeline for d4f7ua_: