Lineage for d4f2ga2 (4f2g A:151-308)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2513849Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2514304Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2514305Protein automated matches [226938] (26 species)
    not a true protein
  7. 2514348Species Burkholderia thailandensis [TaxId:271848] [226395] (1 PDB entry)
  8. 2514350Domain d4f2ga2: 4f2g A:151-308 [220959]
    automated match to d1pvva2
    complexed with edo, po4

Details for d4f2ga2

PDB Entry: 4f2g (more details), 2.1 Å

PDB Description: The Crystal Structure of Ornithine carbamoyltransferase from Burkholderia thailandensis E264
PDB Compounds: (A:) Ornithine carbamoyltransferase 1

SCOPe Domain Sequences for d4f2ga2:

Sequence, based on SEQRES records: (download)

>d4f2ga2 c.78.1.0 (A:151-308) automated matches {Burkholderia thailandensis [TaxId: 271848]}
pirgktvawvgdannmlytwiqaarildfklqlstppgyaldaklvdaesapfyqvfddp
neackgadlvttdvwtsmgfeaenearkrafadwcvdeemmshansdalfmhclpahrge
evtagvidgpqsvvwdeaenrlhvqkalmeflllgrl

Sequence, based on observed residues (ATOM records): (download)

>d4f2ga2 c.78.1.0 (A:151-308) automated matches {Burkholderia thailandensis [TaxId: 271848]}
pirgktvawvgdannmlytwiqaarildfklqlstppgyaldaklvdaesapfyqvfddp
neackgadlvttdvwkrafadwcvdeemmshansdalfmhclpahrgeevtagvidgpqs
vvwdeaenrlhvqkalmeflllgrl

SCOPe Domain Coordinates for d4f2ga2:

Click to download the PDB-style file with coordinates for d4f2ga2.
(The format of our PDB-style files is described here.)

Timeline for d4f2ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f2ga1