Lineage for d4f0yb_ (4f0y B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664807Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1664808Protein automated matches [190038] (28 species)
    not a true protein
  7. 1664812Species Acinetobacter haemolyticus [TaxId:29430] [226372] (2 PDB entries)
  8. 1664816Domain d4f0yb_: 4f0y B: [220936]
    automated match to d1s5ka_
    complexed with cl, gol, mg

Details for d4f0yb_

PDB Entry: 4f0y (more details), 2.56 Å

PDB Description: crystal structure of aminoglycoside antibiotic 6'-n-acetyltransferase aac(6')-ig from acinetobacter haemolyticus, apo
PDB Compounds: (B:) Aminoglycoside N(6')-acetyltransferase type 1

SCOPe Domain Sequences for d4f0yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f0yb_ d.108.1.0 (B:) automated matches {Acinetobacter haemolyticus [TaxId: 29430]}
mnikpaseaslkdwlelrnklwsdseashlqemhqllaekyalqllaysdhqaiamleas
irfeyvngtetspvgflegiyvlpahrrsgvatmlirqaevwakqfsctefasdaaldnv
ishamhrslgfqetekvvyfskkid

SCOPe Domain Coordinates for d4f0yb_:

Click to download the PDB-style file with coordinates for d4f0yb_.
(The format of our PDB-style files is described here.)

Timeline for d4f0yb_: