SCOPe 2.04: Domain d4evya_: 4evy A:

Lineage for d4evya_ (4evy A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (28 species)
   not a true protein

7. Species Acinetobacter haemolyticus [TaxId:29430] [226372] (2 PDB entries)

8. Domain d4evya_: 4evy A: [220884]
   automated match to d1s5ka_
   complexed with cl, k, toy

Details for d4evya_

PDB Entry: 4evy, 1.77 Å

PDB Description: crystal structure of aminoglycoside antibiotic 6'-n-acetyltransferase aac(6')-ig from acinetobacter haemolyticus in complex with tobramycin

PDB Compounds: (A:) Aminoglycoside N(6')-acetyltransferase type 1

SCOPe Domain Sequences for d4evya_:

Sequence; same for both SEQRES and ATOM records:

>d4evya_ d.108.1.0 (A:) automated matches {Acinetobacter haemolyticus [TaxId: 29430]}
qgmnikpaseaslkdwlelrnklwsdseashlqemhqllaekyalqllaysdhqaiamle
asirfeyvngtetspvgflegiyvlpahrrsgvatmlirqaevwakqfsctefasdaald
nvishamhrslgfqetekvvyfskkid

Timeline for d4evya_:

• d4evya_ first appeared in SCOPe 2.03
  
• d4evya_ appears in SCOPe 2.05
  
• d4evya_ appears in the current release, SCOPe 2.08, called d4evya1