Lineage for d1bgmj1 (1bgm J:220-333)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762431Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2762432Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2762446Species Escherichia coli [TaxId:562] [49306] (46 PDB entries)
    Uniprot P00722
  8. 2762689Domain d1bgmj1: 1bgm J:220-333 [22083]
    Other proteins in same PDB: d1bgmi3, d1bgmi4, d1bgmi5, d1bgmj3, d1bgmj4, d1bgmj5, d1bgmk3, d1bgmk4, d1bgmk5, d1bgml3, d1bgml4, d1bgml5, d1bgmm3, d1bgmm4, d1bgmm5, d1bgmn3, d1bgmn4, d1bgmn5, d1bgmo3, d1bgmo4, d1bgmo5, d1bgmp3, d1bgmp4, d1bgmp5
    complexed with mg
    complexed with mg

Details for d1bgmj1

PDB Entry: 1bgm (more details), 2.5 Å

PDB Description: beta-galactosidase (chains i-p)
PDB Compounds: (J:) beta-galactosidase

SCOPe Domain Sequences for d1bgmj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgmj1 b.1.4.1 (J:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d1bgmj1:

Click to download the PDB-style file with coordinates for d1bgmj1.
(The format of our PDB-style files is described here.)

Timeline for d1bgmj1: