Lineage for d1bgmm3 (1bgm M:3-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774233Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2774234Protein beta-Galactosidase [49804] (3 species)
  7. 2774242Species Escherichia coli [TaxId:562] [49805] (46 PDB entries)
    Uniprot P00722
  8. 2774367Domain d1bgmm3: 1bgm M:3-219 [23730]
    Other proteins in same PDB: d1bgmi1, d1bgmi2, d1bgmi4, d1bgmi5, d1bgmj1, d1bgmj2, d1bgmj4, d1bgmj5, d1bgmk1, d1bgmk2, d1bgmk4, d1bgmk5, d1bgml1, d1bgml2, d1bgml4, d1bgml5, d1bgmm1, d1bgmm2, d1bgmm4, d1bgmm5, d1bgmn1, d1bgmn2, d1bgmn4, d1bgmn5, d1bgmo1, d1bgmo2, d1bgmo4, d1bgmo5, d1bgmp1, d1bgmp2, d1bgmp4, d1bgmp5
    complexed with mg
    complexed with mg

Details for d1bgmm3

PDB Entry: 1bgm (more details), 2.5 Å

PDB Description: beta-galactosidase (chains i-p)
PDB Compounds: (M:) beta-galactosidase

SCOPe Domain Sequences for d1bgmm3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgmm3 b.18.1.5 (M:3-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1bgmm3:

Click to download the PDB-style file with coordinates for d1bgmm3.
(The format of our PDB-style files is described here.)

Timeline for d1bgmm3: