Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
Species Escherichia coli [TaxId:562] [49306] (46 PDB entries) Uniprot P00722 |
Domain d1dp0c2: 1dp0 C:626-730 [22078] Other proteins in same PDB: d1dp0a3, d1dp0a4, d1dp0a5, d1dp0b3, d1dp0b4, d1dp0b5, d1dp0c3, d1dp0c4, d1dp0c5, d1dp0d3, d1dp0d4, d1dp0d5 complexed with dms, mg, na |
PDB Entry: 1dp0 (more details), 1.7 Å
SCOPe Domain Sequences for d1dp0c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dp0c2 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d1dp0c2:
View in 3D Domains from same chain: (mouse over for more information) d1dp0c1, d1dp0c3, d1dp0c4, d1dp0c5 |