Class b: All beta proteins [48724] (180 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
Protein beta-Galactosidase, domain 5 [49996] (2 species) |
Species Escherichia coli [TaxId:562] [49997] (46 PDB entries) Uniprot P00722 |
Domain d1dp0c4: 1dp0 C:731-1023 [24348] Other proteins in same PDB: d1dp0a1, d1dp0a2, d1dp0a3, d1dp0a5, d1dp0b1, d1dp0b2, d1dp0b3, d1dp0b5, d1dp0c1, d1dp0c2, d1dp0c3, d1dp0c5, d1dp0d1, d1dp0d2, d1dp0d3, d1dp0d5 complexed with dms, mg, na |
PDB Entry: 1dp0 (more details), 1.7 Å
SCOPe Domain Sequences for d1dp0c4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dp0c4 b.30.5.1 (C:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d1dp0c4:
View in 3D Domains from same chain: (mouse over for more information) d1dp0c1, d1dp0c2, d1dp0c3, d1dp0c5 |