Lineage for d1dp0c4 (1dp0 C:731-1023)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2781621Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2781622Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 2781630Species Escherichia coli [TaxId:562] [49997] (46 PDB entries)
    Uniprot P00722
  8. 2781689Domain d1dp0c4: 1dp0 C:731-1023 [24348]
    Other proteins in same PDB: d1dp0a1, d1dp0a2, d1dp0a3, d1dp0a5, d1dp0b1, d1dp0b2, d1dp0b3, d1dp0b5, d1dp0c1, d1dp0c2, d1dp0c3, d1dp0c5, d1dp0d1, d1dp0d2, d1dp0d3, d1dp0d5
    complexed with dms, mg, na

Details for d1dp0c4

PDB Entry: 1dp0 (more details), 1.7 Å

PDB Description: e. coli beta-galactosidase at 1.7 angstrom
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1dp0c4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dp0c4 b.30.5.1 (C:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d1dp0c4:

Click to download the PDB-style file with coordinates for d1dp0c4.
(The format of our PDB-style files is described here.)

Timeline for d1dp0c4: