SCOPe 2.04: Domain d4eolb1: 4eol B:176-309

Lineage for d4eolb1 (4eol B:176-309)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (74 PDB entries)
   Uniprot P20248 175-432

8. Domain d4eolb1: 4eol B:176-309 [220760]
   Other proteins in same PDB: d4eola_, d4eolc_
   automated match to d1h1pb1
   complexed with 1ro, mg, sgm

Details for d4eolb1

PDB Entry: 4eol, 2.4 Å

PDB Description: thr 160 phosphorylated cdk2 h84s, q85m, k89d - human cyclin a3 complex with the inhibitor ro3306

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d4eolb1:

Sequence; same for both SEQRES and ATOM records:

>d4eolb1 a.74.1.1 (B:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaap

Timeline for d4eolb1:

• d4eolb1 first appeared in SCOPe 2.03
  
• d4eolb1 appears in SCOPe 2.05
  
• d4eolb1 appears in the current release, SCOPe 2.08