SCOPe 2.03: Domain d4enqb2: 4enq B:598-753

Lineage for d4enqb2 (4enq B:598-753)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [226043] (12 PDB entries)

8. Domain d4enqb2: 4enq B:598-753 [220700]
   Other proteins in same PDB: d4enqa1, d4enqb1, d4enqc1, d4enqd1
   automated match to d1p80a1
   complexed with hdd

Details for d4enqb2

PDB Entry: 4enq, 1.9 Å

PDB Description: Structure of E530D variant E. coli KatE

PDB Compounds: (B:) catalase hpii

SCOPe Domain Sequences for d4enqb2:

Sequence; same for both SEQRES and ATOM records:

>d4enqb2 c.23.16.0 (B:598-753) automated matches {Escherichia coli [TaxId: 83333]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

Timeline for d4enqb2:

• d4enqb2 is new in SCOPe 2.03-stable
  
• d4enqb2 appears in SCOPe 2.04
  
• d4enqb2 appears in the current release, SCOPe 2.08