Lineage for d1bj8__ (1bj8 -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (16 proteins) 
Protein Cytokyne receptor gp130 cytokine-binding domains [49295] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49296] (3 PDB entries) 
Domain d1bj8__: 1bj8 - [22070]
Details for d1bj8__
PDB Entry: 1bj8 (more details)
PDB Description: third n-terminal domain of gp130, nmr, minimized average structure
SCOP Domain Sequences for d1bj8__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bj8__ b.1.2.1 (-) Cytokyne receptor gp130 cytokine-binding domains {Human (Homo sapiens)}
mdkvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqipped
tastrssftvqdlkpfteyvfrircmkedgkgywsdwseeasgityedr
SCOP Domain Coordinates for d1bj8__:
Click to download the PDB-style file with coordinates for d1bj8__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bj8__:
- d1bj8__ first appeared (with stable ids) in SCOP 1.55
- d1bj8__ appears in SCOP 1.59
- d1bj8__ appears in the current release, SCOPe 2.08, called d1bj8a1
View in 3D