![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries) |
![]() | Domain d1bj8a1: 1bj8 A:3-109 [22070] Other proteins in same PDB: d1bj8a2 3rd N-terminal domain |
PDB Entry: 1bj8 (more details)
SCOPe Domain Sequences for d1bj8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bj8a1 b.1.2.1 (A:3-109) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} kvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqippedta strssftvqdlkpfteyvfrircmkedgkgywsdwseeasgityedr
Timeline for d1bj8a1: