Lineage for d4elra_ (4elr A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2164349Species Thermus thermophilus HB8 [TaxId:300852] [226637] (8 PDB entries)
  8. 2164372Domain d4elra_: 4elr A: [220628]
    automated match to d1xvya_
    complexed with co3, fe

Details for d4elra_

PDB Entry: 4elr (more details), 2.5 Å

PDB Description: Ferric binding protein with iron and carbonate
PDB Compounds: (A:) Iron ABC transporter, periplasmic iron-binding protein

SCOPe Domain Sequences for d4elra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4elra_ c.94.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
sptltiysgrgqslveplvkqfeaetgirvqvrystdaqilaalqeegsrspadlfwant
agalgqasakgllrplgetllekpiafvpasrtwvpvtvrlrvlaynpdrikaeelpesl
ldlprfarekglvgrvgwtptyssfqdmvagmialygeektrewllamkalapkaypsnp
amldairagevdlgstnhyyvvrfrragyrlgmhhfrdgdagnlalvtgagllktsknla
aatrfltyllspqaqqyfvgnigeyplvkgvaldpnllpleealakspkldleklpldra
lrllretgvl

SCOPe Domain Coordinates for d4elra_:

Click to download the PDB-style file with coordinates for d4elra_.
(The format of our PDB-style files is described here.)

Timeline for d4elra_: