SCOP 1.69: Domain d1fg9c1: 1fg9 C:12-109

Lineage for d1fg9c1 (1fg9 C:12-109)

Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (1 family)
Family b.1.2.1: Fibronectin type III [49266] (24 proteins)
Protein Interferon-gamma receptor alpha chain [49293] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries)
Domain d1fg9c1: 1fg9 C:12-109 [22060]
Other proteins in same PDB: d1fg9a_, d1fg9b_

Details for d1fg9c1

PDB Entry: 1fg9 (more details), 2.9 Å

PDB Description: 3:1 complex of interferon-gamma receptor with interferon-gamma dimer

SCOP Domain Sequences for d1fg9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fg9c1 b.1.2.1 (C:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens)}
vptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycnis
dhvgdpsnslwvrvkarvgqkesayakseefavcrdgk

SCOP Domain Coordinates for d1fg9c1:

Click to download the PDB-style file with coordinates for d1fg9c1.
(The format of our PDB-style files is described here.)

Timeline for d1fg9c1: