Lineage for d4ejia_ (4eji A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005604Domain d4ejia_: 4eji A: [220581]
    automated match to d1dt6a_
    complexed with 0qa, hem

Details for d4ejia_

PDB Entry: 4eji (more details), 2.1 Å

PDB Description: human cytochrome p450 2a13 in complex with two molecules of 4- (methylnitrosamino)-1-(3-puridyl)-1-butanone
PDB Compounds: (A:) Cytochrome P450 2A13

SCOPe Domain Sequences for d4ejia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ejia_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr

SCOPe Domain Coordinates for d4ejia_:

Click to download the PDB-style file with coordinates for d4ejia_.
(The format of our PDB-style files is described here.)

Timeline for d4ejia_: