Lineage for d4ejgh_ (4ejg H:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005662Domain d4ejgh_: 4ejg H: [220572]
    Other proteins in same PDB: d4ejgd2, d4ejge2, d4ejgf2
    automated match to d1dt6a_
    complexed with gol, hem, nct

Details for d4ejgh_

PDB Entry: 4ejg (more details), 2.5 Å

PDB Description: human cytochrome p450 2a13 in complex with nicotine
PDB Compounds: (H:) Cytochrome P450 2A13

SCOPe Domain Sequences for d4ejgh_:

Sequence, based on SEQRES records: (download)

>d4ejgh_ a.104.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkeal
vdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriqe
eagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfqf
tatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfidsf
lirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvheei
drvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgtev
fpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelfl
ffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr

Sequence, based on observed residues (ATOM records): (download)

>d4ejgh_ a.104.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkeal
vdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgieeriqeeagfl
idalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfqftatst
gqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfidsflirmq
eeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvheeidrvig
knrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgtevfpmlg
svlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelflfftti
mqnfrfkspqspkdidvspkhvgfatiprnytmsflpr

SCOPe Domain Coordinates for d4ejgh_:

Click to download the PDB-style file with coordinates for d4ejgh_.
(The format of our PDB-style files is described here.)

Timeline for d4ejgh_: