SCOPe 2.04: Domain d4e8ob_: 4e8o B:

Lineage for d4e8ob_ (4e8o B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (28 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [226348] (1 PDB entry)

8. Domain d4e8ob_: 4e8o B: [220377]
   automated match to d1s5ka_
   complexed with cl

Details for d4e8ob_

PDB Entry: 4e8o, 2.14 Å

PDB Description: crystal structure of aminoglycoside antibiotic 6'-n-acetyltransferase aac(6')-ih from acinetobacter baumannii

PDB Compounds: (B:) Aac(6')-Ih protein

SCOPe Domain Sequences for d4e8ob_:

Sequence; same for both SEQRES and ATOM records:

>d4e8ob_ d.108.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
qgmnimpisesqlsdwlalrcllwpdhedvhlqemrqlitqahrlqllaytdtqqaiaml
easiryeyvngtqtspvaflegifvlpeyrrsgiatglvqqveiwakqfactefasdaal
dnqishamhqalgfhetervvyfkknig

Timeline for d4e8ob_:

• d4e8ob_ first appeared in SCOPe 2.03
  
• d4e8ob_ appears in SCOPe 2.05
  
• d4e8ob_ appears in the current release, SCOPe 2.08, called d4e8ob1