Lineage for d4e8oa_ (4e8o A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426873Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1426874Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1427400Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1427401Protein automated matches [190038] (22 species)
    not a true protein
  7. 1427402Species Acinetobacter baumannii [TaxId:470] [226348] (1 PDB entry)
  8. 1427403Domain d4e8oa_: 4e8o A: [220376]
    automated match to d1s5ka_
    complexed with cl

Details for d4e8oa_

PDB Entry: 4e8o (more details), 2.14 Å

PDB Description: crystal structure of aminoglycoside antibiotic 6'-n-acetyltransferase aac(6')-ih from acinetobacter baumannii
PDB Compounds: (A:) Aac(6')-Ih protein

SCOPe Domain Sequences for d4e8oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e8oa_ d.108.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
gmnimpisesqlsdwlalrcllwpdhedvhlqemrqlitqahrlqllaytdtqqaiamle
asiryeyvngtqtspvaflegifvlpeyrrsgiatglvqqveiwakqfactefasdaald
nqishamhqalgfhetervvyfkknig

SCOPe Domain Coordinates for d4e8oa_:

Click to download the PDB-style file with coordinates for d4e8oa_.
(The format of our PDB-style files is described here.)

Timeline for d4e8oa_: