Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (22 species) not a true protein |
Species Acinetobacter baumannii [TaxId:470] [226348] (1 PDB entry) |
Domain d4e8oa_: 4e8o A: [220376] automated match to d1s5ka_ complexed with cl |
PDB Entry: 4e8o (more details), 2.14 Å
SCOPe Domain Sequences for d4e8oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e8oa_ d.108.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]} gmnimpisesqlsdwlalrcllwpdhedvhlqemrqlitqahrlqllaytdtqqaiamle asiryeyvngtqtspvaflegifvlpeyrrsgiatglvqqveiwakqfactefasdaald nqishamhqalgfhetervvyfkknig
Timeline for d4e8oa_: