| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
| Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
| Protein automated matches [190038] (49 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:470] [226348] (1 PDB entry) |
| Domain d4e8oa1: 4e8o A:1-146 [220376] Other proteins in same PDB: d4e8oa2, d4e8ob2 automated match to d1s5ka_ complexed with cl |
PDB Entry: 4e8o (more details), 2.14 Å
SCOPe Domain Sequences for d4e8oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e8oa1 d.108.1.0 (A:1-146) automated matches {Acinetobacter baumannii [TaxId: 470]}
mnimpisesqlsdwlalrcllwpdhedvhlqemrqlitqahrlqllaytdtqqaiamlea
siryeyvngtqtspvaflegifvlpeyrrsgiatglvqqveiwakqfactefasdaaldn
qishamhqalgfhetervvyfkknig
Timeline for d4e8oa1: