Lineage for d4e8oa1 (4e8o A:1-146)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2968972Species Acinetobacter baumannii [TaxId:470] [226348] (1 PDB entry)
  8. 2968973Domain d4e8oa1: 4e8o A:1-146 [220376]
    Other proteins in same PDB: d4e8oa2, d4e8ob2
    automated match to d1s5ka_
    complexed with cl

Details for d4e8oa1

PDB Entry: 4e8o (more details), 2.14 Å

PDB Description: crystal structure of aminoglycoside antibiotic 6'-n-acetyltransferase aac(6')-ih from acinetobacter baumannii
PDB Compounds: (A:) Aac(6')-Ih protein

SCOPe Domain Sequences for d4e8oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e8oa1 d.108.1.0 (A:1-146) automated matches {Acinetobacter baumannii [TaxId: 470]}
mnimpisesqlsdwlalrcllwpdhedvhlqemrqlitqahrlqllaytdtqqaiamlea
siryeyvngtqtspvaflegifvlpeyrrsgiatglvqqveiwakqfactefasdaaldn
qishamhqalgfhetervvyfkknig

SCOPe Domain Coordinates for d4e8oa1:

Click to download the PDB-style file with coordinates for d4e8oa1.
(The format of our PDB-style files is described here.)

Timeline for d4e8oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4e8oa2