![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (188 species) not a true protein |
![]() | Species Silkworm (Bombyx mori) [TaxId:7091] [226183] (9 PDB entries) |
![]() | Domain d4e8hd1: 4e8h D:1-89 [220374] Other proteins in same PDB: d4e8ha2, d4e8ha3, d4e8hb2, d4e8hb3, d4e8hc2, d4e8hc3, d4e8hd2, d4e8hd3 automated match to d1r5aa2 complexed with gsh |
PDB Entry: 4e8h (more details), 2.12 Å
SCOPe Domain Sequences for d4e8hd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e8hd1 c.47.1.0 (D:1-89) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]} mpvqpiklyylppsppcravmmtarvleldlhlittnimngehmtpeylkmnpqhtiptm ddngfilwesraiqtylvnaygkddslyp
Timeline for d4e8hd1: