SCOPe 2.04: Domain d4e8ea1: 4e8e A:0-89

Lineage for d4e8ea1 (4e8e A:0-89)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (133 species)
   not a true protein

7. Species Silkworm (Bombyx mori) [TaxId:7091] [226183] (8 PDB entries)

8. Domain d4e8ea1: 4e8e A:0-89 [220360]
   Other proteins in same PDB: d4e8ea2, d4e8eb2, d4e8ec2, d4e8ed2
   automated match to d1r5aa2

Details for d4e8ea1

PDB Entry: 4e8e, 2.51 Å

PDB Description: Structural characterization of Bombyx mori glutathione transferase BmGSTD1

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d4e8ea1:

Sequence; same for both SEQRES and ATOM records:

>d4e8ea1 c.47.1.0 (A:0-89) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
hmpvqpiklyylppsppcravmmtarvleldlhlittnimngehmtpeylkmnpqhtipt
mddngfilwesraiqtylvnaygkddslyp

Timeline for d4e8ea1:

• d4e8ea1 first appeared in SCOPe 2.03
  
• d4e8ea1 appears in SCOPe 2.05
  
• d4e8ea1 appears in the current release, SCOPe 2.08