SCOPe 2.08: Domain d4e7ob1: 4e7o B:1-130

Lineage for d4e7ob1 (4e7o B:1-130)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:171101] [226388] (5 PDB entries)

8. Domain d4e7ob1: 4e7o B:1-130 [220355]
   Other proteins in same PDB: d4e7oa2, d4e7ob2
   automated match to d3ffwa_
   complexed with mg

Details for d4e7ob1

PDB Entry: 4e7o, 2.2 Å

PDB Description: Crystal structure of receiver domain of putative NarL family response regulator spr1814 from Streptococcus pneumoniae

PDB Compounds: (B:) Response regulator

SCOPe Domain Sequences for d4e7ob1:

Sequence; same for both SEQRES and ATOM records:

>d4e7ob1 c.23.1.0 (B:1-130) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
mkvlvaedqsmlrdamcqlltlqpdvesvlqakngqeaiqllekesvdiaildvempvkt
glevlewirsekletkvvvvttfkragyferavkagvdayvlkersiadlmqtlhtvleg
rkeyspelme

Timeline for d4e7ob1:

• d4e7ob1 first appeared in SCOPe 2.03, called d4e7ob_
  
• d4e7ob1 appears in SCOPe 2.07