| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (86 species) not a true protein |
| Species Streptococcus pneumoniae [TaxId:171101] [226388] (5 PDB entries) |
| Domain d4e7oa1: 4e7o A:1-129 [220354] Other proteins in same PDB: d4e7oa2, d4e7ob2 automated match to d3ffwa_ complexed with mg |
PDB Entry: 4e7o (more details), 2.2 Å
SCOPe Domain Sequences for d4e7oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e7oa1 c.23.1.0 (A:1-129) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
mkvlvaedqsmlrdamcqlltlqpdvesvlqakngqeaiqllekesvdiaildvempvkt
glevlewirsekletkvvvvttfkragyferavkagvdayvlkersiadlmqtlhtvleg
rkeyspelm
Timeline for d4e7oa1: