Lineage for d4e52c1 (4e52 C:204-234)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2643822Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 2643823Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 2643895Protein Surfactant protein [57949] (3 species)
  7. 2643896Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries)
  8. 2643929Domain d4e52c1: 4e52 C:204-234 [220311]
    Other proteins in same PDB: d4e52a2, d4e52b2, d4e52c2
    automated match to d1pwba2
    complexed with ca, gmh, kd5

Details for d4e52c1

PDB Entry: 4e52 (more details), 1.7 Å

PDB Description: crystal structure of haemophilus eagan 4a polysaccharide bound human lung surfactant protein d
PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d4e52c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e52c1 h.1.1.1 (C:204-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
vaslrqqvealqgqvqhlqaafsqykkvelf

SCOPe Domain Coordinates for d4e52c1:

Click to download the PDB-style file with coordinates for d4e52c1.
(The format of our PDB-style files is described here.)

Timeline for d4e52c1: