Lineage for d4e4ji_ (4e4j I:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668076Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1668077Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1668203Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 1668204Protein automated matches [190175] (6 species)
    not a true protein
  7. 1668227Species Mycoplasma penetrans [TaxId:272633] [226512] (1 PDB entry)
  8. 1668236Domain d4e4ji_: 4e4j I: [220296]
    automated match to d1rxxa_
    complexed with cl

Details for d4e4ji_

PDB Entry: 4e4j (more details), 2.3 Å

PDB Description: Crystal structure of arginine deiminase from Mycoplasma penetrans
PDB Compounds: (I:) Arginine deiminase

SCOPe Domain Sequences for d4e4ji_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e4ji_ d.126.1.0 (I:) automated matches {Mycoplasma penetrans [TaxId: 272633]}
ginvyseigelkevlvhtpgdeirytapsrleellfsavlkadtaieehkgfvkilqnng
ikviqlcdlvaetyelcskevrnsfieqyldealpvlkkeirpvvkdyllsfptvqmvrk
mmsgilanelnikqdnpliidgmpnlyftrdpfasmgngvsincmkyptrkrevifsrfv
ftnnpkykntpryfdivgnngtieggdifiynsktlvignsertnfaaiesvakniqank
dctferivvinvppmpnlmhldtwltmldydkflyspnmmnvlkiweidlnvkpvkfvek
kgtleevlysiidkkpilipiagkganqldidiethfdgtnyltiapgvvvgyernektq
kalveagikvlsfngsqlslgmgsarcmsmplirenlkk

SCOPe Domain Coordinates for d4e4ji_:

Click to download the PDB-style file with coordinates for d4e4ji_.
(The format of our PDB-style files is described here.)

Timeline for d4e4ji_: