Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Rhizobium etli [TaxId:347834] [226316] (3 PDB entries) |
Domain d4e3za_: 4e3z A: [220246] automated match to d2c07a1 |
PDB Entry: 4e3z (more details), 2 Å
SCOPe Domain Sequences for d4e3za_:
Sequence, based on SEQRES records: (download)
>d4e3za_ c.2.1.0 (A:) automated matches {Rhizobium etli [TaxId: 347834]} sdtpvvlvtggsrgigaavcrlaarqgwrvgvnyaanreaadavvaaitesggeavaipg dvgnaadiaamfsavdrqfgrldglvnnagivdypqrvdemsveriermlrvnvtgsilc aaeavrrmsrlysgqggaivnvssmaailgsatqyvdyaaskaaidtftiglarevaaeg irvnavrpgiietdlhasgglpdraremapsvpmqragmpeevadailyllspsasyvtg silnvsggr
>d4e3za_ c.2.1.0 (A:) automated matches {Rhizobium etli [TaxId: 347834]} sdtpvvlvtggsrgigaavcrlaarqgwrvgvnyaanreaadavvaaitesggeavaipg dvgnaadiaamfsavdrqfgrldglvnnagivdypqrvdemsveriermlrvnvtgsilc aaeavrrmsrlysgqggaivnvssmaailgsatqyvdyaaskaaidtftiglarevaaeg irvnavrpgiiesvpmqragmpeevadailyllspsasyvtgsilnvsggr
Timeline for d4e3za_: