Lineage for d4e3ma_ (4e3m A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690268Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1690287Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (95 PDB entries)
  8. 1690296Domain d4e3ma_: 4e3m A: [220238]
    automated match to d1my8a_
    complexed with 0nd, po4

Details for d4e3ma_

PDB Entry: 4e3m (more details), 1.44 Å

PDB Description: Crystal structure of AmpC beta-lactamase in complex with a 2-chloro-4-tetrazolyl benzene sulfonamide boronic acid inhibitor
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4e3ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e3ma_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOPe Domain Coordinates for d4e3ma_:

Click to download the PDB-style file with coordinates for d4e3ma_.
(The format of our PDB-style files is described here.)

Timeline for d4e3ma_: