Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (28 proteins) Pfam 00041 |
Protein Erythropoietin (EPO) receptor [49282] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries) |
Domain d1ebaa1: 1eba A:10-116 [22015] |
PDB Entry: 1eba (more details), 2.7 Å
SCOP Domain Sequences for d1ebaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ebaa1 b.1.2.1 (A:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens)} kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin
Timeline for d1ebaa1: