Lineage for d1ebaa1 (1eba A:10-116)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 9780Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 9781Family b.1.2.1: Fibronectin type III [49266] (14 proteins)
  6. 9793Protein Erythropoietin (EPO) receptor [49282] (1 species)
  7. 9794Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)
  8. 9799Domain d1ebaa1: 1eba A:10-116 [22015]

Details for d1ebaa1

PDB Entry: 1eba (more details), 2.7 Å

PDB Description: complex between the extracellular domain of erythropoietin (epo) receptor [ebp] and an inactive peptide [emp33] contains 3,5-dibromotyrosine in position 4 (denoted dby)

SCOP Domain Sequences for d1ebaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebaa1 b.1.2.1 (A:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

SCOP Domain Coordinates for d1ebaa1:

Click to download the PDB-style file with coordinates for d1ebaa1.
(The format of our PDB-style files is described here.)

Timeline for d1ebaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ebaa2