| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (239 species) not a true protein |
| Species Acinetobacter baylyi [TaxId:202950] [226522] (3 PDB entries) |
| Domain d4dyda1: 4dyd A:1-189 [220104] Other proteins in same PDB: d4dyda2 automated match to d1f17a2 complexed with gol, nad, po4, so4 |
PDB Entry: 4dyd (more details), 1.95 Å
SCOPe Domain Sequences for d4dyda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dyda1 c.2.1.0 (A:1-189) automated matches {Acinetobacter baylyi [TaxId: 202950]}
mtgitnvtvlgtgvlgsqiafqtafhgfavtaydintdaldaakkrfeglaavyekevag
aadgaaqkalggirysddlaqavkdadlvieavpesldlkrdiytklgelapaktifatn
sstllpsdlvgytgrgdkflalhfanhvwvnntaevmgttktdpevyqqvvefasaigmv
pielkkeka
Timeline for d4dyda1: