SCOPe 2.07: Domain d4dxeb1: 4dxe B:1-117

Lineage for d4dxeb1 (4dxe B:1-117)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.0: automated matches [191589] (1 protein)
   not a true family

6. Protein automated matches [191061] (11 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [226319] (4 PDB entries)

8. Domain d4dxeb1: 4dxe B:1-117 [220088]
   Other proteins in same PDB: d4dxea2, d4dxeb2, d4dxec2, d4dxed2, d4dxee2, d4dxef2, d4dxeg1, d4dxeg2, d4dxeh1, d4dxeh2, d4dxei1, d4dxei2, d4dxej1, d4dxej2, d4dxek1, d4dxek2, d4dxel1, d4dxel2
   automated match to d3hyka_
   complexed with mli

Details for d4dxeb1

PDB Entry: 4dxe, 2.51 Å

PDB Description: 2.52 angstrom resolution crystal structure of the acyl-carrier-protein synthase (acps)-acyl carrier protein (acp) protein-protein complex from staphylococcus aureus subsp. aureus col

PDB Compounds: (B:) acyl-carrier-protein synthase

SCOPe Domain Sequences for d4dxeb1:

Sequence, based on SEQRES records:

>d4dxeb1 d.150.1.0 (B:1-117) automated matches {Staphylococcus aureus [TaxId: 93062]}
mihgigvdlieidriqalyskqpklveriltkneqhkfnnftheqrkieflagrfatkea
fskalgtglgkhvafndidcyndelgkpkidyegfivhvsishtehyamsqvvleks

Sequence, based on observed residues (ATOM records):

>d4dxeb1 d.150.1.0 (B:1-117) automated matches {Staphylococcus aureus [TaxId: 93062]}
mihgigvdlieidriqalyskqpklveriltkneqhkfnnftheqrkieflagrfatkea
fskalgtgvafndidcyndkpkidyegfivhvsishtehyamsqvvleks

Timeline for d4dxeb1:

• d4dxeb1 first appeared in SCOPe 2.03, called d4dxeb_
  
• d4dxeb1 appears in SCOPe 2.06
  
• d4dxeb1 appears in the current release, SCOPe 2.08