SCOPe 2.07: Domain d4dvhb2: 4dvh B:89-201

Lineage for d4dvhb2 (4dvh B:89-201)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (37 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:353153] [226483] (2 PDB entries)

8. Domain d4dvhb2: 4dvh B:89-201 [220054]
   Other proteins in same PDB: d4dvha1, d4dvha3, d4dvhb1, d4dvhb3
   automated match to d1jr9a2
   complexed with fe

Details for d4dvhb2

PDB Entry: 4dvh, 2.23 Å

PDB Description: Crystal structure of Trypanosoma cruzi mitochondrial iron superoxide dismutase

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d4dvhb2:

Sequence; same for both SEQRES and ATOM records:

>d4dvhb2 d.44.1.0 (B:89-201) automated matches {Trypanosoma cruzi [TaxId: 353153]}
ngkampkslesavtaqfgsveqfkdafvqagvnnfgsgwtwlcvdpsnknqlvidntsna
gcpltkglrpvlavdvwehayykdfenrrpdylkeiwsvidwefvakmhaqai

Timeline for d4dvhb2:

• d4dvhb2 first appeared in SCOPe 2.03
  
• d4dvhb2 appears in SCOPe 2.06
  
• d4dvhb2 appears in the current release, SCOPe 2.08