Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50587] (88 PDB entries) Uniprot P00749 156-178,179-424 |
Domain d4dvau_: 4dva U: [220045] automated match to d4fuba_ complexed with p6g, so4 |
PDB Entry: 4dva (more details), 1.94 Å
SCOPe Domain Sequences for d4dvau_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dvau_ b.47.1.2 (U:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw irshtk
Timeline for d4dvau_: