Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (26 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:235909] [226399] (6 PDB entries) |
Domain d4ds5d1: 4ds5 D:296-468 [219996] Other proteins in same PDB: d4ds5a2, d4ds5d2 automated match to d1nk4a1 protein/DNA complex; complexed with so4 |
PDB Entry: 4ds5 (more details), 1.68 Å
SCOPe Domain Sequences for d4ds5d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ds5d1 c.55.3.0 (D:296-468) automated matches {Geobacillus kaustophilus [TaxId: 235909]} lakmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladp qfvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaak mkqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn
Timeline for d4ds5d1: