SCOP 1.75: Domain d1qg3b2: 1qg3 B:1218-1320

Lineage for d1qg3b2 (1qg3 B:1218-1320)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
   Pfam PF00041

6. Protein Integrin beta-4 subunit [49278] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49279] (1 PDB entry)

8. Domain d1qg3b2: 1qg3 B:1218-1320 [21996]
   first tandem pair of FnIII domains
   complexed with cac, so4

Details for d1qg3b2

PDB Entry: 1qg3, 2.15 Å

PDB Description: crystal structure of a tandem pair of fibronectin type iii domains from the cytoplasmic tail of integrin alpha6 beta4

PDB Compounds: (B:) protein (integrin beta-4 subunit)

SCOP Domain Sequences for d1qg3b2:

Sequence; same for both SEQRES and ATOM records:

>d1qg3b2 b.1.2.1 (B:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}
evpsepgrlafnvvsstvtqlswaepaetngeitayevcyglvnddnrpigpmkkvlvdn
pknrmllienlresqpyrytvkarngagwgpereaiinlatqp

Timeline for d1qg3b2:

• d1qg3b2 first appeared (with stable ids) in SCOP 1.55
  
• d1qg3b2 appears in SCOP 1.73
  
• d1qg3b2 appears in SCOPe 2.01
  
• d1qg3b2 appears in the current release, SCOPe 2.08