SCOP 1.59: Domain d1qg3b2: 1qg3 B:1218-1320

Lineage for d1qg3b2 (1qg3 B:1218-1320)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Integin beta-4 subunit [49278] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49279] (1 PDB entry)

8. Domain d1qg3b2: 1qg3 B:1218-1320 [21996]

Details for d1qg3b2

PDB Entry: 1qg3, 2.15 Å

PDB Description: crystal structure of a tandem pair of fibronectin type iii domains from the cytoplasmic tail of integrin alpha6 beta4

SCOP Domain Sequences for d1qg3b2:

Sequence; same for both SEQRES and ATOM records:

>d1qg3b2 b.1.2.1 (B:1218-1320) Integin beta-4 subunit {Human (Homo sapiens)}
evpsepgrlafnvvsstvtqlswaepaetngeitayevcyglvnddnrpigpmkkvlvdn
pknrmllienlresqpyrytvkarngagwgpereaiinlatqp

Timeline for d1qg3b2:

• d1qg3b2 first appeared (with stable ids) in SCOP 1.55
  
• d1qg3b2 appears in SCOP 1.57
  
• d1qg3b2 appears in SCOP 1.61
  
• d1qg3b2 appears in the current release, SCOPe 2.08