Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (42 species) not a true protein |
Species Mycobacterium marinum [TaxId:216594] [226310] (1 PDB entry) |
Domain d4dq8a2: 4dq8 A:187-386 [219929] automated match to d1g99a2 |
PDB Entry: 4dq8 (more details), 2.25 Å
SCOPe Domain Sequences for d4dq8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dq8a2 c.55.1.0 (A:187-386) automated matches {Mycobacterium marinum [TaxId: 216594]} pigdlnqivlhlgngasasavaggrpvetsmgltpleglvmgtrsgdldpgvigylwrta klgvdeiesmlnhrsgmlglagerdfrrlramiddgdpaaelaydvfihrlrkyvgayla vlghtdvvsftagigehdaavrrdtlagmaelgislderrnacpsggarrisaddspvtv lviptneelaiarhccsvlv
Timeline for d4dq8a2: