Class b: All beta proteins [48724] (176 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Plastocyanin [49507] (16 species) |
Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (16 PDB entries) |
Domain d4dp8x_: 4dp8 X: [219901] automated match to d1plca_ complexed with cu1, so4 |
PDB Entry: 4dp8 (more details), 1.07 Å
SCOPe Domain Sequences for d4dp8x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dp8x_ b.6.1.1 (X:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn
Timeline for d4dp8x_: