Lineage for d4dlga2 (4dlg A:423-832)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1692262Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1692263Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1692264Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 1692265Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 1692331Species Thermus aquaticus [TaxId:271] [56676] (24 PDB entries)
  8. 1692336Domain d4dlga2: 4dlg A:423-832 [219846]
    Other proteins in same PDB: d4dlga1
    automated match to d1jxea2
    protein/DNA complex; complexed with act, dct, gol, mg

Details for d4dlga2

PDB Entry: 4dlg (more details), 1.89 Å

PDB Description: Ternary Structure of the large Fragment of Taq DNA polymerase
PDB Compounds: (A:) DNA polymerase I, thermostable

SCOPe Domain Sequences for d4dlga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dlga2 e.8.1.1 (A:423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake

SCOPe Domain Coordinates for d4dlga2:

Click to download the PDB-style file with coordinates for d4dlga2.
(The format of our PDB-style files is described here.)

Timeline for d4dlga2: