SCOPe 2.08: Domain d4dlda_: 4dld A:

Lineage for d4dlda_ (4dld A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)

8. Domain d4dlda_: 4dld A: [219843]
   automated match to d1ycjb_
   complexed with cl, gol, so4, tzg

Details for d4dlda_

PDB Entry: 4dld, 2 Å

PDB Description: crystal structure of the gluk1 ligand-binding domain (s1s2) in complex with the antagonist (s)-2-amino-3-(2-(2-carboxyethyl)-5-chloro-4- nitrophenyl)propionic acid at 2.0 a resolution

PDB Compounds: (A:) Glutamate receptor, ionotropic kainate 1

SCOPe Domain Sequences for d4dlda_:

Sequence; same for both SEQRES and ATOM records:

>d4dlda_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nrtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkyg
aqndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpids
addlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvlt
tdyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegk
lhmmkekwwrgngcp

Timeline for d4dlda_:

• d4dlda_ first appeared in SCOPe 2.03
  
• d4dlda_ appears in SCOPe 2.07