Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
Protein automated matches [190158] (18 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [226499] (2 PDB entries) |
Domain d4dikb2: 4dik B:251-398 [219782] Other proteins in same PDB: d4dika1, d4dikb1 automated match to d1vmea1 complexed with cl, feo; mutant |
PDB Entry: 4dik (more details), 1.75 Å
SCOPe Domain Sequences for d4dikb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dikb2 c.23.5.0 (B:251-398) automated matches {Thermotoga maritima [TaxId: 2336]} pkkgkvtviydsmygfvenvmkkaidslkekgftpvvykfsdeerpaiseilkdipdsea lifgvstyeaeihplmrftlleiidkanyekpvlvfgvhgwapsaertagellketkfri lsfteikgsnmderkieeaisllkkele
Timeline for d4dikb2: