Lineage for d4dhwa_ (4dhw A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497093Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2497110Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2497111Protein automated matches [193326] (11 species)
    not a true protein
  7. 2497165Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193327] (9 PDB entries)
  8. 2497172Domain d4dhwa_: 4dhw A: [219767]
    automated match to d4jc4a_
    complexed with 0l1

Details for d4dhwa_

PDB Entry: 4dhw (more details), 2.43 Å

PDB Description: Crystal structure of Peptidyl-tRNA hydrolase from Pseudomonas aeruginosa with Adipic acid at 2.4 Angstrom resolution
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4dhwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhwa_ c.56.3.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mtavqlivglgnpgpeydqtrhnagalfverlahaqgvslvadrkyfglvgkfshqgkdv
rllipttymnrsgqsvaalagffriapdailvahdeldmppgvaklktggghgghnglrd
iiaqlgnqnsfhrlrlgighpghsslvsgyvlgraprseqelldtsidfalgvlpemlag
dwtramqklhsqka

SCOPe Domain Coordinates for d4dhwa_:

Click to download the PDB-style file with coordinates for d4dhwa_.
(The format of our PDB-style files is described here.)

Timeline for d4dhwa_: