Lineage for d4dgea_ (4dge A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553283Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1553284Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1553285Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1553529Protein automated matches [190077] (17 species)
    not a true protein
  7. 1553592Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [189056] (4 PDB entries)
  8. 1553597Domain d4dgea_: 4dge A: [219747]
    Other proteins in same PDB: d4dgec_, d4dged_
    automated match to d4dgda_
    mutant

Details for d4dgea_

PDB Entry: 4dge (more details), 2.2 Å

PDB Description: TRIMCyp cyclophilin domain from Macaca mulatta: H70C mutant, HIV-1 CA(O-loop) complex
PDB Compounds: (A:) trimcyp

SCOPe Domain Sequences for d4dgea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dgea_ b.62.1.1 (A:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggnfthcngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d4dgea_:

Click to download the PDB-style file with coordinates for d4dgea_.
(The format of our PDB-style files is described here.)

Timeline for d4dgea_: