SCOPe 2.04: Domain d4dgea_: 4dge A:

Lineage for d4dgea_ (4dge A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (17 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [189056] (4 PDB entries)

8. Domain d4dgea_: 4dge A: [219747]
   Other proteins in same PDB: d4dgec_, d4dged_
   automated match to d4dgda_
   mutant

Details for d4dgea_

PDB Entry: 4dge, 2.2 Å

PDB Description: TRIMCyp cyclophilin domain from Macaca mulatta: H70C mutant, HIV-1 CA(O-loop) complex

PDB Compounds: (A:) trimcyp

SCOPe Domain Sequences for d4dgea_:

Sequence; same for both SEQRES and ATOM records:

>d4dgea_ b.62.1.1 (A:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggnfthcngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d4dgea_:

• d4dgea_ first appeared in SCOPe 2.03
  
• d4dgea_ appears in SCOPe 2.05
  
• d4dgea_ appears in the current release, SCOPe 2.08