SCOPe 2.04: Domain d4dfwa2: 4dfw A:501-593

Lineage for d4dfwa2 (4dfw A:501-593)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.223: Polo-box domain [82614] (1 superfamily)
   beta(6)-alpha; antiparallel beta-sheet, meander

4. Superfamily d.223.1: Polo-box domain [82615] (2 families)
   Serine/threonine protein kinase-associated motif embedded in two distinct folds

5. Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
   duplication: consists of two polo-box domains; binds phosphothreonine peptide

6. Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102858] (18 PDB entries)

8. Domain d4dfwa2: 4dfw A:501-593 [219743]
   automated match to d1umwa2
   complexed with cl

Details for d4dfwa2

PDB Entry: 4dfw, 1.55 Å

PDB Description: oxime-based post solid-phase peptide diversification: identification of high affinity polo-like kinase 1 (plk1) polo-box domain binding peptides

PDB Compounds: (A:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d4dfwa2:

Sequence; same for both SEQRES and ATOM records:

>d4dfwa2 d.223.1.2 (A:501-593) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
egdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfr
tyrlslleeygcckelasrlryartmvdkllss

Timeline for d4dfwa2:

• d4dfwa2 first appeared in SCOPe 2.03
  
• d4dfwa2 appears in SCOPe 2.05
  
• d4dfwa2 appears in the current release, SCOPe 2.08