SCOP 1.75: Domain d1fnfa2: 1fnf A:1236-1326

Lineage for d1fnfa2 (1fnf A:1236-1326)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
   Pfam PF00041

6. Protein Fibronectin, different Fn3 modules [49270] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49271] (9 PDB entries)

8. Domain d1fnfa2: 1fnf A:1236-1326 [21973]
   repeats 7 through 10

Details for d1fnfa2

PDB Entry: 1fnf, 2 Å

PDB Description: fragment of human fibronectin encompassing type-iii repeats 7 through 10

PDB Compounds: (A:) Fibronectin

SCOP Domain Sequences for d1fnfa2:

Sequence; same for both SEQRES and ATOM records:

>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}
vppptdlrftnigpdtmrvtwapppsidltnflvryspvkneedvaelsispsdnavvlt
nllpgteyvvsvssvyeqhestplrgrqktg

Timeline for d1fnfa2:

• d1fnfa2 first appeared (with stable ids) in SCOP 1.55, called d1fnf_2
  
• d1fnfa2 appears in SCOP 1.73
  
• d1fnfa2 appears in SCOPe 2.01
  
• d1fnfa2 appears in the current release, SCOPe 2.08