Lineage for d4de3b_ (4de3 B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949998Protein automated matches [190161] (23 species)
    not a true protein
  7. 1950053Species Escherichia coli [TaxId:562] [187306] (55 PDB entries)
  8. 1950099Domain d4de3b_: 4de3 B: [219718]
    automated match to d2p74a_
    complexed with dms, dn8

Details for d4de3b_

PDB Entry: 4de3 (more details), 1.44 Å

PDB Description: CTX-M-9 class A beta-lactamase complexed with compound 4
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d4de3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4de3b_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
savqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetq
kqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpgg
vtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraql
vtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqpq
qnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d4de3b_:

Click to download the PDB-style file with coordinates for d4de3b_.
(The format of our PDB-style files is described here.)

Timeline for d4de3b_: